Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SLC7A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC7A2 Antibody: synthetic peptide directed towards the middle region of human SLC7A2. Synthetic peptide located within the following region: VANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATC

SLC7A2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Chimpanzee, Gorilla, Human, Mouse, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen SLC7A2 antibody was raised against synthetic 12 amino acid peptide from internal region of human SLC7A2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Mouse, Rat, Rabbit, Pig (100%); Orangutan, Gibbon, Galago, Marmoset, Hamster, Bovine, Bat, Horse (92%); Panda, Dog, Platypus (83%).

SLC7A2 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Chimpanzee, Human, Orang-Utan, Gorilla
Conjugation Unconjugated
Immunogen SLC7A2 antibody was raised against synthetic 12 amino acid peptide from C-Terminus of human SLC7A2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan (100%); Gibbon (92%); Monkey, Marmoset, Opossum, Turkey (83%).

SLC7A2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SLC7A2

SLC7A2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human SLC7A2 (NP_001008539.3).
Modifications Unmodified