Primary Antibodies

Jump to Filters
View as table Download
STX19 (C-term) Rabbit Polyclonal Antibody
AP54088PU-N

USD 450.00

2 Weeks

STX19 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 257-288 amino acids from the C-terminal region of Human STX19.
STX19 Rabbit Polyclonal Antibody
TA336197

USD 375.00

5 Days

Rabbit Polyclonal Anti-STX19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-STX19 Antibody: synthetic peptide directed towards the N terminal of human STX19. Synthetic peptide located within the following region: LQQAVIYEREPVAERHLHEIQKLQESINNLADNVQKFGQQQKSLVASMRR
STX19 Rabbit Polyclonal Antibody
TA350477

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-STX19 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein