Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ITPK1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ITPK1 Antibody: A synthesized peptide derived from human ITPK1

Rabbit Polyclonal antibody to ITPK1 (inositol 1,3,4-triphosphate 5/6 kinase)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 171 and 414 of ITPK1 (Uniprot ID#Q13572)

Rabbit polyclonal anti-ITPK1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ITPK1.

Rabbit Polyclonal Anti-ITPK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITPK1 antibody: synthetic peptide directed towards the N terminal of human ITPK1. Synthetic peptide located within the following region: MEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYI

Carrier-free (BSA/glycerol-free) ITPK1 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ITPK1 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ITPK1 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated