Rabbit anti-FMO3 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FMO3 |
Rabbit anti-FMO3 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FMO3 |
Rabbit Polyclonal Anti-FMO3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FMO3 antibody: synthetic peptide directed towards the N terminal of human FMO3. Synthetic peptide located within the following region: MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEG |
Rabbit Polyclonal Anti-FMO3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FMO3 antibody: synthetic peptide directed towards the N terminal of human FMO3. Synthetic peptide located within the following region: FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTE |
Carrier-free (BSA/glycerol-free) FMO3 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FMO3 mouse monoclonal antibody,clone OTI1G3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FMO3 mouse monoclonal antibody,clone OTI1G4
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
FMO3 Rabbit polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from the Internal region of human FMO3. AA range:101-150 |
FMO3 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FMO3 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FMO3 mouse monoclonal antibody,clone OTI1G3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
FMO3 mouse monoclonal antibody,clone OTI1G3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
FMO3 mouse monoclonal antibody,clone OTI1G4
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
FMO3 mouse monoclonal antibody,clone OTI1G4
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |