Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-MAK Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAK antibody: synthetic peptide directed towards the C terminal of human MAK. Synthetic peptide located within the following region: WNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR

Rabbit polyclonal MAK (Ab-159) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human MAK.

Rabbit polyclonal MAK (Tyr159) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human MAK around the phosphorylation site of tyrosine 159 (T-D-YP-V-S).
Modifications Phospho-specific

Carrier-free (BSA/glycerol-free) MAK mouse monoclonal antibody,clone OTI1G2

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAK mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAK mouse monoclonal antibody, clone OTI5F1 (formerly 5F1)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAK mouse monoclonal antibody,clone OTI5A11

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAK mouse monoclonal antibody, clone OTI5A7

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAK mouse monoclonal antibody,clone OTI5A7

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

MAK Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 370-435 of human MAK (NP_005897.1).
Modifications Unmodified

MAK mouse monoclonal antibody,clone OTI1G2

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

MAK mouse monoclonal antibody,clone OTI1G2

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

MAK mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

MAK mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

MAK mouse monoclonal antibody, clone OTI5F1 (formerly 5F1)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

MAK mouse monoclonal antibody, clone OTI5F1 (formerly 5F1)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

MAK mouse monoclonal antibody,clone OTI5A11

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

MAK mouse monoclonal antibody,clone OTI5A11

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

MAK mouse monoclonal antibody,clone OTI5A7

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

MAK mouse monoclonal antibody,clone OTI5A7

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

MAK mouse monoclonal antibody,clone OTI5A7

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

MAK mouse monoclonal antibody,clone OTI5A7

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated