Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-MYLK3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MYLK3 Antibody is: synthetic peptide directed towards the C-terminal region of Human MYLK3. Synthetic peptide located within the following region: LVKEKSCRMSATQCLKHEWLNNLPAKASRSKTRLKSQLLLQKYIAQRKWK

Rabbit Polyclonal Anti-MYLK3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MYLK3

MYLK3 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human MYLK3 (NP_872299.2).
Modifications Unmodified