Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PGLS Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGLS antibody: synthetic peptide directed towards the middle region of human PGLS. Synthetic peptide located within the following region: AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL

Rabbit polyclonal anti-PGLS antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PGLS.

PGLS Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PGLS

PGLS Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-258 of human PGLS (NP_036220.1).
Modifications Unmodified