Germany
Japan
United Kingdom
China
ACCN4 (ASIC4) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 22-52 amino acids from the N-terminal region of human ACCN4 |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-ACCN4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACCN4 antibody: synthetic peptide directed towards the middle region of human ACCN4. Synthetic peptide located within the following region: NLTRYGKEISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTS |
Rabbit Polyclonal Anti-ACCN4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACCN4 antibody: synthetic peptide directed towards the N terminal of human ACCN4. Synthetic peptide located within the following region: SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLA |
