Rabbit polyclonal anti-F2RL2 antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human F2RL2. |
Rabbit polyclonal anti-F2RL2 antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human F2RL2. |
Rabbit Polyclonal Anti-F2RL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-F2RL2 antibody: synthetic peptide directed towards the C terminal of human F2RL2. Synthetic peptide located within the following region: HANYYYNNTDGLYFIYLIALCLGSLNSCLDPFLYFLMSKTRNHSTAYLTK |
Rabbit Polyclonal Anti-F2RL2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human F2RL2 |