Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-NCOR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NCOR2 antibody: synthetic peptide directed towards the N terminal of human NCOR2. Synthetic peptide located within the following region: DKEDLLKEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEA

Rabbit polyclonal anti-NCOR2 antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NCOR2.

Rabbit Polyclonal Anti-NCOR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NCOR2 antibody: synthetic peptide directed towards the N terminal of human NCOR2. Synthetic peptide located within the following region: PMPRSSQEEKDEKEKEKEAEKEEEKPEVENDKEDLLKEKTDDTSGEDNDE

NCOR2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human NCOR2

NCOR2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human NCOR2

NCOR2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 670-900 of human NCOR2 (NP_006303.4).
Modifications Unmodified