Primary Antibodies

Jump to Filters
View as table Download
PGLS Rabbit Polyclonal Antibody
TA344307

USD 475.00

5 Days

Rabbit Polyclonal Anti-PGLS Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGLS antibody: synthetic peptide directed towards the middle region of human PGLS. Synthetic peptide located within the following region: AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL
PGLS Rabbit Polyclonal Antibody
TA315287

USD 345.00

In Stock

Rabbit polyclonal anti-PGLS antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PGLS.
PGLS Rabbit Polyclonal Antibody
TA379847

USD 220.00

3 Weeks

PGLS Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-258 of human PGLS (NP_036220.1).
Modifications Unmodified