Primary Antibodies

Jump to Filters
View as table Download
PPIL1 Rabbit Polyclonal Antibody
TA338053

USD 375.00

5 Days

Rabbit Polyclonal Anti-PPIL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPIL1 antibody is: synthetic peptide directed towards the N-terminal region of Human PPIL1. Synthetic peptide located within the following region: YWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASI
PPIL1 Rabbit Polyclonal Antibody
TA350297

USD 345.00

In Stock

Rabbit Polyclonal Anti-PPIL1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein
PPIL1 Rabbit Polyclonal Antibody
TA364932

USD 380.00

4 Weeks

PPIL1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein
PPIL1 Rabbit Polyclonal Antibody
TA380217

USD 220.00

3 Weeks

PPIL1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human PPIL1 (NP_057143.1).
Modifications Unmodified