Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PYGB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PYGB antibody: synthetic peptide directed towards the N terminal of human PYGB. Synthetic peptide located within the following region: QQHYYERDPKRIYYLSLEFYMGRTLQNTMVNLGLQNACDEAIYQLGLDLE

Rabbit Polyclonal Anti-PYGB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PYGB antibody: synthetic peptide directed towards the N terminal of human PYGB. Synthetic peptide located within the following region: ADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAMPYDT

GPBB / PYGB Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey, Rabbit
Immunogen GPBB / PYGB antibody was raised against synthetic 12 amino acid peptide from C-terminus of human PYGB. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Rabbit (100%); Orangutan, Mouse, Rat, Dog, Hamster, Elephant, Panda, Horse (92%); Turkey, Chicken, Platypus, Xenopus (83%).

GPBB / PYGB Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey, Orang-Utan
Immunogen GPBB / PYGB antibody was raised against synthetic 10 amino acid peptide from internal region of human PYGB. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant (100%); Mouse, Bat, Hamster, Opossum, Platypus (90%); Rat, Dog, Panda, Horse, Rabbit, Lizard, Salmon, Pufferfish, Zebrafish (80%).

Anti-PYGB Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-15 amino acids of Human phosphorylase, glycogen; brain

Anti-PYGB Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-15 amino acids of Human phosphorylase, glycogen; brain

PYGB Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 544-843 of human PYGB (NP_002853.2).
Modifications Unmodified

PYGB Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 544-843 of human PYGB (NP_002853.2).
Modifications Unmodified