Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to SEC13L1 (SEC13 homolog (S. cerevisiae))

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 319 of SEC13L1 (Uniprot ID#P55735)

Rabbit Polyclonal Anti-SEC13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SEC13 antibody is: synthetic peptide directed towards the middle region of Human SEC13. Synthetic peptide located within the following region: GHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDS

Rabbit Polyclonal Anti-SEC13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEC13 antibody is: synthetic peptide directed towards the C-terminal region of Human SEC13. Synthetic peptide located within the following region: IKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRV

SEC13 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-322 of human SEC13 (NP_899195.1).
Modifications Unmodified