Primary Antibodies

View as table Download

Rabbit polyclonal antibody to SFMBT1 (Scm-like with four mbt domains 1)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 13 and 225 of SFMBT1 (Uniprot ID#Q9UHJ3)

Rabbit Polyclonal Anti-SFMBT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SFMBT1 antibody is: synthetic peptide directed towards the middle region of Human SFMBT1. Synthetic peptide located within the following region: PGNCVLVLREVLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVLKAKYKG