Primary Antibodies

View as table Download

SGCG rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SGCG

Rabbit polyclonal SGCG Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SGCG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 145-172 amino acids from the Central region of human SGCG.

Rabbit Polyclonal Anti-SGCG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGCG antibody: synthetic peptide directed towards the middle region of human SGCG. Synthetic peptide located within the following region: FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS

SGCG rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SGCG

SGCG Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 72-291 of human SGCG (NP_000222.1).
Modifications Unmodified