Primary Antibodies

View as table Download

Rabbit anti-CDC42 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CDC42

Chicken Polyclonal CDC42 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CDC42 antibody was raised against a 17 amino acid peptide near the amino terminus of human CDC42.

Rabbit polyclonal anti-cdc42/Rac antibody

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptides surrounding amino acid 144 of human cdc42

Rabbit Polyclonal Anti-CDC42 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC42 antibody: synthetic peptide directed towards the N terminal of human CDC42. Synthetic peptide located within the following region: DNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSP

Anti-Cdc42/Rho/Rac Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 57-71 amino acids of Human Cell division cycle 42