Primary Antibodies

View as table Download

Goat Anti-HLA-DQA2 & HLA-DQA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QGLRSVGASRH, from the C Terminus of the protein sequence according to NP_064440.1; NP_002113.2.

Rabbit polyclonal Anti-HLA-DQA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the N terminal of human HLA-DQA2. Synthetic peptide located within the following region: GVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQS

Rabbit polyclonal Anti-HLA-DQA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the middle region of human HLA-DQA2. Synthetic peptide located within the following region: LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK

Carrier-free (BSA/glycerol-free) HLA-DQA2 mouse monoclonal antibody,clone OTI3E6

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HLA-DQA2 mouse monoclonal antibody,clone OTI4C9

Applications WB
Reactivities Human
Conjugation Unconjugated

HLA-DQA2 mouse monoclonal antibody,clone OTI3E6

Applications WB
Reactivities Human
Conjugation Unconjugated

HLA-DQA2 mouse monoclonal antibody,clone OTI3E6

Applications WB
Reactivities Human
Conjugation Unconjugated

HLA-DQA2 mouse monoclonal antibody,clone OTI4C9

Applications WB
Reactivities Human
Conjugation Unconjugated

HLA-DQA2 mouse monoclonal antibody,clone OTI4C9

Applications WB
Reactivities Human
Conjugation Unconjugated