Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-GSTM5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTM5 antibody: synthetic peptide directed towards the N terminal of human GSTM5. Synthetic peptide located within the following region: MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEK

GSTM5 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 21-51 amino acids from the N-terminal region of Human GSTM5