Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PIGV Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIGV antibody: synthetic peptide directed towards the N terminal of human PIGV. Synthetic peptide located within the following region: FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE

PIGV (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 342-371aa) of human PIGV.