Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SLC11A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC11A1 Antibody: synthetic peptide directed towards the C terminal of human SLC11A1. Synthetic peptide located within the following region: VLLTRSCAILPTVLVAVFRDLRDLSGLNDLLNVLQSLLLPFAVLPILTFT

Rabbit polyclonal SLC11A1 Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SLC11A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 250-276 amino acids from the Central region of human SLC11A1.

Rabbit Polyclonal Anti-SLC11A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC11A1 Antibody is: synthetic peptide directed towards the middle region of Human SLC11A1. Synthetic peptide located within the following region: GYEYVVARPEQGALLRGLFLPSCPGCGHPELLQAVGIVGAIIMPHNIYLH