Primary Antibodies

View as table Download

OR1J4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 275-303 amino acids from the C-terminal region of human OR1J4

Rabbit Polyclonal Anti-OR1J4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR1J4 antibody is: synthetic peptide directed towards the C-terminal region of Human OR1J4. Synthetic peptide located within the following region: ALSTCGSHLSVVSLYYGTIIGLYFLPSSSASSDKDVIASVMYTVITPLLN