Primary Antibodies

View as table Download

EFTUD2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 263~293 amino acids from the Center region of human EFTUD2

Rabbit Polyclonal Anti-EFTUD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EFTUD2 Antibody is: synthetic peptide directed towards the middle region of Human EFTUD2. Synthetic peptide located within the following region: ADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPL