Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ZMAT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZMAT2 antibody: synthetic peptide directed towards the middle region of human ZMAT2. Synthetic peptide located within the following region: KEKQKEKKRRAEEDLTFEEDDEMAAVMGFSGFGSTKKSY

Rabbit Polyclonal Anti-ZMAT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZMAT2 antibody: synthetic peptide directed towards the N terminal of human ZMAT2. Synthetic peptide located within the following region: AEKRLTEEREKKDGKPVQPVKRELLRHRDYKVDLESKLGKTIVITKTTPQ

ZMAT2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 161-190 amino acids from the C-terminal region of human ZMAT2