Rabbit Polyclonal Anti-Antxr2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Antxr2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GLVPSYAENEAKKSRSLGASVYCVGVLDFEQAQLERIADSKDQVFPVKGG |
Goat Anti-ANTXR2 / CMG2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HEGLKLANEQIQK, from the internal regoin of the protein sequence according to NP_477520.2; NP_001139266.1. |
ANTXR2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 339-488 of human ANTXR2 (NP_477520.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China