Goat Anti-DAG1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HVGKHEYFMHATDK, from the internal region of the protein sequence according to NP_004384.3. |
Goat Anti-DAG1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HVGKHEYFMHATDK, from the internal region of the protein sequence according to NP_004384.3. |
Rabbit Polyclonal Anti-Dag1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Dag1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PPSPGSSAAPATEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAM |
DAG1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 654-749 of human DAG1 (NP_004384.4). |
Modifications | Unmodified |