Rabbit Polyclonal Anti-MED6 Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MED6 Antibody: synthetic peptide directed towards the middle region of human MED6. Synthetic peptide located within the following region: ALLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKN |
Carrier-free (BSA/glycerol-free) MED6 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MED6 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MED6 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
MED6 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MED6 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
MED6 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MED6 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MED6 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MED6 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
MED6 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MED6 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
