Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ABHD5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABHD5 antibody: synthetic peptide directed towards the C terminal of human ABHD5. Synthetic peptide located within the following region: SVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQK

Rabbit Polyclonal Anti-ABHD5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABHD5 antibody: synthetic peptide directed towards the N terminal of human ABHD5. Synthetic peptide located within the following region: NRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILL

ABHD5 mouse monoclonal antibody, clone 1F3, Purified

Applications ELISA, IHC, WB
Reactivities Human

Anti-ABHD5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 297 amino acids of human abhydrolase domain containing 5

Goat Polyclonal Antibody against CGI58 / ABHD5

Applications WB
Reactivities Human.Mouse, Cow
Conjugation Unconjugated
Immunogen Peptide with sequence C-FPERPDLADQDR, from the internal region of the protein sequence according to NP_057090.2.

Rabbit Polyclonal Antibody against CGI58

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region within residues 200-300 of the human protein. [Swiss-Prot# Q8WTS1]

Anti-ABHD5 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 297 amino acids of human abhydrolase domain containing 5