Rabbit Polyclonal Anti-AGK Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGK antibody: synthetic peptide directed towards the N terminal of human AGK. Synthetic peptide located within the following region: DNLLRRAACQEAQVFGNQLIPPNAQVKKATVFLNPAACKGKARTLFEKNA |
Rabbit Polyclonal Anti-AGK Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGK antibody: synthetic peptide directed towards the N terminal of human AGK. Synthetic peptide located within the following region: KKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGE |
Goat Polyclonal Antibody against AGK
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDPRKREQMLTSP, from the C Terminus of the protein sequence according to NP_060708.1. |
AGK Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human AGK |
AGK Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AGK |
AGK Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 233-422 of human AGK (NP_060708.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China