Rabbit Polyclonal Anti-GSTA3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTA3 antibody: synthetic peptide directed towards the middle region of human GSTA3. Synthetic peptide located within the following region: SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFR |
GSTA3 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GSTA3. |
GSTA3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human GSTA3 |
GSTA3 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-222 of human GSTA3 (NP_000838.3). |
| Modifications | Unmodified |
GSTA3 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
