Primary Antibodies

View as table Download

Rabbit Polyclonal Antibody against GBL (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GBL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 140-170 amino acids from the Central region of human GBL.

MLST8 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MLST8

Rabbit Polyclonal Anti-GBL Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GBL antibody: synthetic peptide directed towards the middle region of human GBL. Synthetic peptide located within the following region: CAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVL

MLST8 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MLST8

Rabbit Polyclonal GBL Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GbL antibody was raised against a 14 amino acid peptide from near the carboxy-terminus of human GbL.

Anti-MLST8 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

MLST8 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human LST8

MLST8 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MLST8

MLST8 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MLST8

MLST8 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-326 of human MLST8 (NP_001186103.1).
Modifications Unmodified