Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-RXRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRB antibody: synthetic peptide directed towards the C terminal of human RXRB. Synthetic peptide located within the following region: AKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIG

Rabbit Polyclonal Anti-RXRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRB antibody: synthetic peptide directed towards the N terminal of human RXRB. Synthetic peptide located within the following region: MHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGRDGMGDSG

Retinoid X Receptor beta (RXRB) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 262~292 amino acids from the Central region of Human RXRB

Goat Polyclonal Antibody against RXR beta

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CRDGMGDSGRDSRSP, from the internal region of the protein sequence according to NP_068811.

Rabbit polyclonal antibody to Retinoid X Receptor beta (retinoid X receptor, beta)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 20 and 113 of Retinoid X Receptor beta (Uniprot ID#P28702)

Mouse Anti-Retinoid X Receptor, b-Isotype Antibody

Applications WB
Reactivities Rat

Rabbit Polyclonal Anti-RXRB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRB antibody: synthetic peptide directed towards the N terminal of human RXRB. Synthetic peptide located within the following region: GDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPP

Rabbit Polyclonal Anti-RXRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRB antibody: synthetic peptide directed towards the N terminal of human RXRB. Synthetic peptide located within the following region: PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA

RXRB Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RXRB.