Primary Antibodies

Jump to Filters
View as table Download
EGFR Rabbit Polyclonal Antibody
TA312545

USD 345.00

4 Weeks

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).
FGF2 Rabbit Polyclonal Antibody
TA346315

USD 475.00

5 Days

Rabbit Polyclonal Anti-FGF2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
FGF21 Goat Polyclonal Antibody
TA303289

USD 375.00

In Stock

Goat Polyclonal Antibody against FGF21

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CQRPDGALYGSLH, from the internal region of the protein sequence according to NP_061986.1.
FGF2 Mouse Monoclonal Antibody [Clone ID: OTI3D9]
TA500012

USD 379.00

In Stock

bFGF (FGF2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
FGF2 Mouse Monoclonal Antibody [Clone ID: OTI3D9]
TA500012S

USD 159.00

In Stock

bFGF (FGF2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
EGFR Mouse Monoclonal Antibody [Clone ID: UMAB95]
UM570070

USD 180.00

In Stock

EGFR mouse monoclonal antibody,clone UMAB95

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated