Primary Antibodies

Jump to Filters
View as table Download
RDH11 Rabbit Polyclonal Antibody
TA346621

USD 475.00

5 Days

Rabbit Polyclonal Anti-RDH11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RDH11 antibody: synthetic peptide directed towards the C terminal of human RDH11. Synthetic peptide located within the following region: SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIAR
RDH11 Rabbit Polyclonal Antibody
TA350339

USD 345.00

In Stock

Rabbit Polyclonal Anti-RDH11 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RDH11
RDH11 Rabbit Polyclonal Antibody
TA380824

USD 220.00

3 Weeks

RDH11 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RDH11.