Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-RAB30 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RAB30 antibody is: synthetic peptide directed towards the C-terminal region of Human RAB30. Synthetic peptide located within the following region: EIEQYASNKVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKE

Rabbit Polyclonal Anti-RAB30 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RAB30 antibody is: synthetic peptide directed towards the C-terminal region of Human RAB30. Synthetic peptide located within the following region: ERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQN