Primary Antibodies

View as table Download

Rabbit polyclonal antibody to Rad9 (RAD9 homolog A (S. pombe))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 197 and 391 of Rad9

Rabbit Polyclonal Antibody against RAD9A

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This RAD9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human RAD9.

Rabbit Polyclonal Antibody against RAD9

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of full length human Rad9 protein

Goat Polyclonal Antibody against RAD9A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QGPSPVLAEDSEGE, from the C Terminus of the protein sequence according to NP_004575.1.

Anti-RAD9A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 230 amino acids of human RAD9 homolog A (S. pombe)

Rabbit Polyclonal Anti-RAD9A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD9A antibody: synthetic peptide directed towards the C terminal of human RAD9A. Synthetic peptide located within the following region: SLSPGPQPPKSPGPHSEEEDEAEPSTVPGTPPPKKFRSLFFGSILAPVRS

RAD9A Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 162-391 of human RAD9A (NP_004575.1).
Modifications Unmodified