Primary Antibodies

Jump to Filters
View as table Download
FBXW2 Goat Polyclonal Antibody
TA302888

USD 375.00

5 Days

Goat Polyclonal Antibody against FBXW2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-KRGSSFLAGEHPG, from the C Terminus of the protein sequence according to NP_036296.1.
FBXW2 Rabbit Polyclonal Antibody
TA329817

USD 375.00

5 Days

Rabbit Polyclonal Anti-FBXW2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXW2 antibody: synthetic peptide directed towards the middle region of human FBXW2. Synthetic peptide located within the following region: SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI