Primary Antibodies

View as table Download

Rabbit anti-RBP4 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant Protein of human RBP4

Rabbit Polyclonal Anti-RBP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBP4 antibody: synthetic peptide directed towards the N terminal of human RBP4. Synthetic peptide located within the following region: MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDP

RBP4 (169-183) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Synthetic Human RBP4 (aa 169-183) KLH-conjugated
(VHNGYCDGRSERNLL)

RBP4 (169-183) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Synthetic Human RBP4 (aa 169-183) KLH-conjugated
(VHNGYCDGRSERNLL)

RBP4 (169-182) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Synthetic Human RBP4 (aa 169-182) KLH-conjugated (VHNGYCDGRSERNL)

RBP4 (169-182) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Synthetic Human RBP4 (aa 169-182) KLH-conjugated (VHNGYCDGRSERNL)

RBP4 (169-181) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Synthetic Human RBP4 (aa 169-181) KLH-conjugated (VHNGYCDGRSERN)

RBP4 (169-181) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Synthetic Human RBP4 (aa 169-181) KLH-conjugated (VHNGYCDGRSERN)

RBP4 (169-179) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Synthetic Human RBP4 (aa 169-179) KLH-conjugated (VHNGYCDGRSE)

RBP4 (169-179) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Synthetic Human RBP4 (aa 169-179) KLH-conjugated (VHNGYCDGRSE)

RBP4 (169-176) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Synthetic Human RBP4 (aa 169-176) KLH-conjugated (VHNGYCDG)

RBP4 (169-176) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Synthetic Human RBP4 (aa 169-176) KLH-conjugated (VHNGYCDG)

RBP4 (1-183) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Native Human RBP4 (aa 1-183) full length (signal peptid cleaved).

RBP4 (1-183) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Native Human RBP4 (aa 1-183) full length (signal peptid cleaved).

Goat Polyclonal Antibody against RBP4

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QKGNDDHWIVDTDYD, from the internal region of the protein sequence according to NP_006735.2.

Goat Polyclonal Antibody against RBP4 (Internal)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DTEDPAKFKMKY, from the internal region of the protein sequence according to NP_006735.2.

Rabbit Polyclonal Anti-RBP4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RBP4