Rabbit Polyclonal Anti-SKI2W Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SKI2W antibody was raised against a 16 amino acid peptide near the amino terminus of human SKI2W. |
Rabbit Polyclonal Anti-SKI2W Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SKI2W antibody was raised against a 16 amino acid peptide near the amino terminus of human SKI2W. |
Rabbit Polyclonal Anti-SHBG Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SHBG antibody was raised against a 16 amino acid peptide near the center of human SHBG. |
USD 450.00
2 Weeks
Sex Hormone Binding Globulin (SHBG) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 69-96 amino acids from the N-terminal region of Human SHBG. |
Rabbit Polyclonal Anti-SHBG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHBG antibody is: synthetic peptide directed towards the C-terminal region of SHBG. Synthetic peptide located within the following region: RGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH |
Rabbit Polyclonal Anti-SHBG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHBG antibody is: synthetic peptide directed towards the N-terminal region of Human SHBG. Synthetic peptide located within the following region: FDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLH |
Anti-SHBG Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 68-81 amino acids of Human sex hormone-binding globulin |
Anti-SHBG Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 68-81 amino acids of Human sex hormone-binding globulin |