Primary Antibodies

Jump to Filters
View as table Download
USP12 (Center) Rabbit Polyclonal Antibody
AP54486PU-N

USD 450.00

2 Weeks

USP12 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 222-251 amino acids from the Central region of human USP12
USP12 Rabbit Polyclonal Antibody
TA333400

USD 375.00

5 Days

Rabbit Polyclonal Anti-USP12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-USP12 Antibody: synthetic peptide directed towards the middle region of human USP12. Synthetic peptide located within the following region: ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNG