USP12 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 222-251 amino acids from the Central region of human USP12 |
USP12 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 222-251 amino acids from the Central region of human USP12 |
Rabbit Polyclonal Anti-USP12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-USP12 Antibody: synthetic peptide directed towards the middle region of human USP12. Synthetic peptide located within the following region: ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNG |