Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian |
Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian |
Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Biotin
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian |
Conjugation | Biotin |
Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian |
Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated |
Rabbit Polyclonal Anti-COL6A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COL6A1 antibody: synthetic peptide directed towards the middle region of human COL6A1. Synthetic peptide located within the following region: ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ |
Collagen VI/COL6A1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-250 of human Collagen VI/Collagen VI/COL6A1 (NP_001839.2). |
Modifications | Unmodified |