Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CYP4F12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP4F12 antibody: synthetic peptide directed towards the middle region of human CYP4F12. Synthetic peptide located within the following region: DGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDV

Rabbit Polyclonal Anti-CYP4F12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP4F12 antibody: synthetic peptide directed towards the C terminal of human CYP4F12. Synthetic peptide located within the following region: TVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVV

CYP4F12 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CYP4F12

CYP4F12 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CYP4F12

CYP4F12 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 265-524 of human CYP4F12 (NP_076433.3).
Modifications Unmodified