Rabbit anti-FOXP2 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FOXP2 |
Rabbit anti-FOXP2 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FOXP2 |
Rabbit Polyclonal Anti-FOXP2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOXP2 Antibody: Peptide sequence around aa.707~711(E-E-P-L-S) derived from Human FOXP2. |
Goat Polyclonal Antibody against FOXP2
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-REIEEEPLSEDLE, from the C Terminus of the protein sequence according to NP_055306.1; NP_683696.2; NP_683697.1. |
Rabbit polyclonal FOXP2 Antibody (C-term)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This FOXP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 657-684 amino acids from the C-terminal region of human FOXP2. |
Rabbit Polyclonal Anti-FOXP2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOXP2 antibody: synthetic peptide directed towards the N terminal of human FOXP2. Synthetic peptide located within the following region: SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA |
Rabbit Polyclonal Anti-FOXP2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOXP2 antibody: synthetic peptide directed towards the N terminal of human FOXP2. Synthetic peptide located within the following region: SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA |
Goat Polyclonal Antibody against FOXP2 (Internal region)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DEVEYQKRRSQKIT, from the internal region of the protein sequence according to NP_055306.1; NP_683696.1; NP_683697.1; NP_683698.1. |
Rabbit anti FOXP2 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the internal region of human FOXP2 protein. This sequence is identical to human, mouse, rat and dog. |
Anti-FOXP2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 701-715 amino acids of Human forkhead box P2 |
FOXP2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FOXP2 |