Primary Antibodies

Jump to Filters
View as table Download
PSMG1 Goat Polyclonal Antibody
TA305649

USD 375.00

5 Days

Goat Anti-DSCR2 / PSMG1 Antibody

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KLMTTNEIQSNIYT, from the C Terminus of the protein sequence according to NP_003711.1; NP_982257.1.
PSMG1 Rabbit Polyclonal Antibody
TA338919

USD 375.00

5 Days

Rabbit Polyclonal Anti-PSMG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMG1 antibody: synthetic peptide directed towards the middle region of human PSMG1. Synthetic peptide located within the following region: VMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT
PSMG1 Rabbit Polyclonal Antibody
TA338920

USD 375.00

5 Days

Rabbit Polyclonal Anti-PSMG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMG1 antibody: synthetic peptide directed towards the middle region of human PSMG1. Synthetic peptide located within the following region: TILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHD
PSMG1 Rabbit Polyclonal Antibody
TA380474

USD 220.00

3 Weeks

PSMG1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-288 of human PSMG1 (NP_003711.1).
Modifications Unmodified