Germany
Japan
United Kingdom
China
Goat Anti-NNMT (aa171-182) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence PDLPTYCRALRN, from the internal region of the protein sequence according to NP_006160.1. |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-NNT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NNT antibody: synthetic peptide directed towards the N terminal of human NNT. Synthetic peptide located within the following region: IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM |
Rabbit Polyclonal Anti-NT5C1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NT5C1A antibody: synthetic peptide directed towards the C terminal of human NT5C1A. Synthetic peptide located within the following region: AHGLDRFFEHEKAHENKPLAQGPLKGFLEALGRLQKKFYSKGLRLECPIR |
Rabbit anti CD38 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-AOX1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human aldehyde oxidase 1 |
Anti-NAMPT Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human nicotinamide phosphoribosyltransferase |
Anti-ENPP3 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 850-864 amino acids of Human ectonucleotide pyrophosphatase/phosphodiesterase 3 |
Rabbit Polyclonal Anti-NT5E Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NT5E |
Rabbit Polyclonal Anti-NT5C1A Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NT5C1A |
Rabbit Polyclonal Anti-BST1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human BST1 |
NMNAT3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NADK Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Clonalities
- Polyclonal
Pathways
- Nicotinate and nicotinamide metabolism