Goat Anti-Fgf14 (mouse N terminus) Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence REQHWDRPSASR-C, from the N Terminus of the protein sequence according to NP_034331.2; NP_997550.1. |
Goat Anti-Fgf14 (mouse N terminus) Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence REQHWDRPSASR-C, from the N Terminus of the protein sequence according to NP_034331.2; NP_997550.1. |
Rabbit Polyclonal Anti-FGF14 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FGF14 antibody: synthetic peptide directed towards the middle region of human FGF14. Synthetic peptide located within the following region: ENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKP |