Primary Antibodies

View as table Download

Rabbit anti-NFKBIB Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NFKBIB

Rabbit Polyclonal Anti-NFKBIB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NFKBIB

Rabbit polyclonal IkB-beta (Ser23) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human: Ser23, Mouse: Ser23, Rat: Ser23
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human I?B-β around the phosphorylation site of serine 23.
Modifications Phospho-specific

Rabbit Polyclonal IkappaB-beta Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IkappaB-beta

Rabbit Polyclonal I kappaB- beta (Thr19) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human I kappaB- beta around the phosphorylation site of Threonine 19
Modifications Phospho-specific

Rabbit Polyclonal I kappaB- beta (Ser23) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human I kappaB- beta around the phosphorylation site of Serine 23
Modifications Phospho-specific

Rabbit Polyclonal Anti-NFKBIB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the C terminal of human NFKBIB. Synthetic peptide located within the following region: MLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVV

IKB beta (NFKBIB) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human

Rabbit polyclonal anti-IKB beta antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IkBb peptide corresponding to a region near the C-terminus of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH).

Anti-NFKBIB (Phospho-Ser23) Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 23 (L-G-S(p)-L-G) derived from Human I?B-β.
Modifications Phospho-specific

Rabbit Polyclonal Anti-NFKBIB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the middle region of human NFKBIB. Synthetic peptide located within the following region: PILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVVHSSRS

Rabbit Polyclonal Anti-NFKBIB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the N terminal of human NFKBIB. Synthetic peptide located within the following region: LVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTAL

Rabbit Polyclonal Anti-NFKBIB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the N terminal of human NFKBIB. Synthetic peptide located within the following region: DLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVCA