Primary Antibodies

View as table Download

Rabbit polyclonal anti-NDUFB10 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NDUFB10.

NDUFB10 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human

Rabbit polyclonal NDUFB10 Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NDUFB10 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 43-70 amino acids from the Central region of human NDUFB10.

Rabbit Polyclonal Anti-NDUFB10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDUFB10 antibody is: synthetic peptide directed towards the C-terminal region of NDUFB10. Synthetic peptide located within the following region: KVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDL