BLBP (FABP7) (101-111) goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Bat, Bovine, Canine, Chicken, Equine, Human, Monkey, Porcine |
Immunogen | Synthetic peptide from the C-terminus of human FABP7 / BLBP (NP_001437.1) |
BLBP (FABP7) (101-111) goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Bat, Bovine, Canine, Chicken, Equine, Human, Monkey, Porcine |
Immunogen | Synthetic peptide from the C-terminus of human FABP7 / BLBP (NP_001437.1) |
Rabbit Polyclonal FABP7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | FABP7 antibody was raised against a 17 amino acid peptide from near the center of human FABP7. |
Anti-FABP7 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-FABP7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FABP7 antibody: synthetic peptide directed towards the N terminal of human FABP7. Synthetic peptide located within the following region: NFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISF |
Anti-FABP7 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |