Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SRP14 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SRP14 antibody: synthetic peptide directed towards the N terminal of human SRP14. Synthetic peptide located within the following region: KPIPKKGTVEGFEPADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLL

SRP14 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated